PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G19800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 315aa    MW: 34031.2 Da    PI: 7.0058
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G19800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.37.5e-083882244
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     g+W++eE + + +a + l  +   +W+++a  ++ g+t  ++  ++
  ORUFI05G19800.1 38 GAWSQEENKVFEQALAALDRNdpeRWERVALLLP-GKTVADVMTHY 82
                     79*****************99*************.********999 PP

2Myb_DNA-binding45.71.6e-14152196347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G g+W+ I+r + + Rt+ q+ s+ qky
  ORUFI05G19800.1 152 PWTEEEHKLFLMGLKKYGRGDWRNISRNFVTSRTPTQVASHAQKY 196
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.8E-73688IPR001005SANT/Myb domain
PROSITE profilePS500906.2493886IPR017877Myb-like domain
PfamPF002491.8E-53882IPR001005SANT/Myb domain
SuperFamilySSF466892.23E-93893IPR009057Homeodomain-like
CDDcd001674.99E-63982No hitNo description
PROSITE profilePS5129417.568145201IPR017930Myb domain
SuperFamilySSF466891.44E-17147201IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-17148199IPR006447Myb domain, plants
SMARTSM007175.8E-13149199IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-12149195IPR009057Homeodomain-like
PfamPF002497.4E-12152196IPR001005SANT/Myb domain
CDDcd001672.12E-11152197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MMKESYMEVL PPAPAHYFVG QAAAAGGWFL PDRRGGGGAW SQEENKVFEQ ALAALDRNDP  60
ERWERVALLL PGKTVADVMT HYDDLENDVC FIEAGLVPFP HYGAAGGGGG SGFTLDWDGG  120
DDPAGLGFKR SCYMVGGKRA RGPDQERKKG VPWTEEEHKL FLMGLKKYGR GDWRNISRNF  180
VTSRTPTQVA SHAQKYFIRL NSGGKDKRRS SIHDITTVNL PDDDHGNPSP SPPPSVLTAH  240
SSSSAAAVSE QFGVLVDGKP PPPPLGRGAG HHHFMPHPYA QVKIEAGNSH VAGGGRLDDS  300
VLVQMQCGQL MQPLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A9e-1834107578RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0681380.0AK068138.1 Oryza sativa Japonica Group cDNA clone:J013135D01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637475.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H73e-82DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0E0PNA90.0A0A0E0PNA9_ORYRU; Uncharacterized protein
TrEMBLQ60EH10.0Q60EH1_ORYSJ; Os05g0449900 protein
STRINGLOC_Os05g37730.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-81MYB family protein